![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000919323 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 101aa MW: 10969.6 Da PI: 9.3324 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 68.2 | 7.9e-22 | 11 | 53 | 3 | 45 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
en+ rq t++kR+ngi+KKA+ELS+LCd+++ +++fs+tgk
MDP0000919323 11 LENTNGRQATYAKRKNGIMKKANELSILCDIDIVLLMFSPTGK 53
589999***********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 1.44E-22 | 1 | 58 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 23.352 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.1E-27 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00120 | 6.58E-23 | 2 | 54 | No hit | No description |
| PRINTS | PR00404 | 2.3E-17 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.8E-20 | 12 | 54 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-17 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-17 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 101 aa Download sequence Send to blast |
MGRVKLKIKG LENTNGRQAT YAKRKNGIMK KANELSILCD IDIVLLMFSP TGKPSLCNGE 60 GRKEGTGKEG TEETGEEATG KEGRNKTPHD VDSHIRCHIM * |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018846114.1 | 5e-31 | PREDICTED: agamous-like MADS-box protein AGL30 isoform X1 | ||||
| Refseq | XP_018846115.1 | 5e-31 | PREDICTED: agamous-like MADS-box protein AGL30 isoform X1 | ||||
| Refseq | XP_018846116.1 | 5e-31 | PREDICTED: agamous-like MADS-box protein AGL30 isoform X1 | ||||
| Refseq | XP_018846117.1 | 5e-31 | PREDICTED: agamous-like MADS-box protein AGL30 isoform X2 | ||||
| Refseq | XP_018846118.1 | 5e-31 | PREDICTED: agamous-like MADS-box protein AGL30 isoform X3 | ||||
| Refseq | XP_018846119.1 | 5e-31 | PREDICTED: agamous-like MADS-box protein AGL30 isoform X4 | ||||
| Swissprot | Q1PFA4 | 1e-27 | AGL30_ARATH; Agamous-like MADS-box protein AGL30 | ||||
| TrEMBL | A0A498I3A2 | 6e-41 | A0A498I3A2_MALDO; Uncharacterized protein | ||||
| STRING | XP_008221600.1 | 3e-31 | (Prunus mume) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF20519 | 5 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03060.1 | 2e-30 | AGAMOUS-like 30 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000919323 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




