PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000934043

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

ZF-HD

Protein Properties

Length: 91aa MW: 9618.7 Da PI: 8.0522

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000934043	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	105.7	2.9e-33	22	78	3	59
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 vrY eC+kNhAa +Gg+avDGC+Efm+s+geegt+aal+CaACgCHRnFHRreve+ MDP0000934043 22 VVRYGECQKNHAAGVGGYAVDGCREFMASNGEEGTTAALTCAACGCHRNFHRREVET 78 69****************************************************875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	8.0E-20	1	87	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	7.6E-30	23	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	4.0E-28	24	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.958	25	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MRKRQVVLRR TEQASAASSF TVVRYGECQK NHAAGVGGYA VDGCREFMAS NGEEGTTAAL 60 TCAACGCHRN FHRREVETVC ECSSPSSNGA *

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.5175	1e-154	cell culture\| fruit\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008379352.1	7e-60	mini zinc finger protein 2
Swissprot	Q9LJW5	1e-40	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A498J4J6	2e-58	A0A498J4J6_MALDO; Uncharacterized protein
STRING	XP_008379352.1	3e-59	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1550	34	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	5e-29	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	MDP0000934043

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]