![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C001111P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 86aa MW: 9646.05 Da PI: 10.666 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 91.5 | 4.2e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng+lKKA+ELSvLCda+va++ifs++gk y +ss
MELO3C001111P1 9 KRIENPTSRQVTFSKRRNGLLKKAYELSVLCDAQVALLIFSPSGKAYQFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.394 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.4E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.06E-43 | 2 | 72 | No hit | No description |
| SuperFamily | SSF55455 | 6.67E-34 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.2E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MGRGKVELKR IENPTSRQVT FSKRRNGLLK KAYELSVLCD AQVALLIFSP SGKAYQFSSH 60 DMDGTLARYR TDVGLPQSNH PHSRAL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 1e-25 | 1 | 83 | 1 | 77 | MEF2C |
| 5f28_B | 1e-25 | 1 | 83 | 1 | 77 | MEF2C |
| 5f28_C | 1e-25 | 1 | 83 | 1 | 77 | MEF2C |
| 5f28_D | 1e-25 | 1 | 83 | 1 | 77 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB046596 | 1e-130 | AB046596.1 Cucumis sativus ERAF17 mRNA for putative MADS-box protein, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004145150.1 | 2e-58 | PREDICTED: truncated transcription factor CAULIFLOWER D-like isoform X2 | ||||
| Swissprot | Q9FIS1 | 9e-33 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | Q9AYR8 | 4e-57 | Q9AYR8_CUCSA; Putative MADS-box protein | ||||
| STRING | XP_008466902.1 | 2e-58 | (Cucumis melo) | ||||
| STRING | XP_004145150.1 | 6e-58 | (Cucumis sativus) | ||||
| STRING | XP_004154125.1 | 6e-58 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.3 | 4e-35 | AGAMOUS-like 42 | ||||




