PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MELO3C007273P1

Organism

Cucumis melo

Taxonomic ID

3656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

SBP

Protein Properties

Length: 108aa MW: 11739.8 Da PI: 5.1624

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C007273P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	75.4	9.7e-24	56	103	1	48
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 +Cq++gC+adl+ a+ yhrrhkvCe+h+ka+vv+++gleqrfCqqCs MELO3C007273P1 56 RCQADGCNADLTGARPYHRRHKVCEFHAKAAVVILAGLEQRFCQQCSS 103 6*********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	5.5E-25	49	102	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	19.512	54	107	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	5.1E-23	55	104	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	7.5E-19	57	103	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 108 aa Download sequence Send to blast
MANSNDHSWE DMILDDDDDD DNDTEEVGFV DNERRRRSGL TTGRGGGGGG RSTVARCQAD 60 GCNADLTGAR PYHRRHKVCE FHAKAAVVIL AGLEQRFCQQ CSSIGIR*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	1e-18	47	104	1	58	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269\|PubMed:12671094, ECO:0000269\|PubMed:16095614, ECO:0000269\|PubMed:17093870}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681875	1e-172	LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBank	LN713262	1e-172	LN713262.1 Cucumis melo genomic chromosome, chr_8.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008439842.1	4e-70	PREDICTED: squamosa promoter-binding protein 1
Swissprot	Q38741	1e-21	SBP1_ANTMA; Squamosa promoter-binding protein 1
Swissprot	Q8GXL3	4e-20	SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBL	A0A1S3AZN8	9e-69	A0A1S3AZN8_CUCME; squamosa promoter-binding protein 1
STRING	XP_008439842.1	2e-69	(Cucumis melo)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G02065.2	3e-23	squamosa promoter binding protein-like 8

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Xing S, et al. SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility. Plants (Basel), 2013. 2(3): p. 416-28 [PMID:27137384] Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]