![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C007400P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 85aa MW: 9865.66 Da PI: 11.9675 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 98.8 | 3.9e-31 | 28 | 77 | 2 | 51 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
prlrWtp+LH++Fv+ave+LGG+e+AtPk +l++m+v+gLt++hvkSHLQ
MELO3C007400P1 28 PRLRWTPDLHRCFVHAVERLGGEERATPKMVLQIMNVNGLTISHVKSHLQ 77
8************************************************* PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.363 | 24 | 84 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-29 | 24 | 77 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.38E-14 | 26 | 78 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.3E-23 | 28 | 78 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 7.0E-8 | 29 | 77 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
MRVSRQRVFH DINFKSPMVR PYVRSKMPRL RWTPDLHRCF VHAVERLGGE ERATPKMVLQ 60 IMNVNGLTIS HVKSHLQVQI GSFL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4r_A | 2e-20 | 29 | 77 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 2e-20 | 29 | 77 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 2e-20 | 29 | 77 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 2e-20 | 29 | 77 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681875 | 7e-81 | LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007. | |||
| GenBank | LN713262 | 7e-81 | LN713262.1 Cucumis melo genomic chromosome, chr_8. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004134975.2 | 1e-48 | PREDICTED: probable transcription factor KAN2 isoform X1 | ||||
| Refseq | XP_016899272.1 | 2e-48 | PREDICTED: probable transcription factor KAN2 isoform X1 | ||||
| Swissprot | Q700D9 | 1e-27 | MYBF_ARATH; Putative Myb family transcription factor At1g14600 | ||||
| TrEMBL | A0A0A0KHB7 | 4e-50 | A0A0A0KHB7_CUCSA; Uncharacterized protein | ||||
| STRING | XP_008439998.1 | 3e-51 | (Cucumis melo) | ||||
| STRING | XP_004155673.1 | 2e-51 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF9381 | 28 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02060.1 | 2e-32 | G2-like family protein | ||||




