![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C008942P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 103aa MW: 12208.5 Da PI: 11.4126 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 91.6 | 3.8e-29 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l +s
MELO3C008942P1 9 KRIENTTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLSQFS 58
79*********************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.871 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.5E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 5.36E-31 | 2 | 83 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.39E-35 | 2 | 75 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.8E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.2E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010152 | Biological Process | pollen maturation | ||||
| GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MGRVKLQIKR IENTTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLSQFSGR 60 RRIEDVLARY INLPDHDRGR YTHFFLFLVF LFFKKKSFFL KM* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6bz1_A | 2e-19 | 1 | 86 | 1 | 85 | MEF2 CHIMERA |
| 6bz1_B | 2e-19 | 1 | 86 | 1 | 85 | MEF2 CHIMERA |
| 6bz1_C | 2e-19 | 1 | 86 | 1 | 85 | MEF2 CHIMERA |
| 6bz1_D | 2e-19 | 1 | 86 | 1 | 85 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681882 | 1e-98 | LN681882.1 Cucumis melo genomic scaffold, anchoredscaffold00010. | |||
| GenBank | LN713262 | 1e-98 | LN713262.1 Cucumis melo genomic chromosome, chr_8. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008442144.1 | 5e-51 | PREDICTED: agamous-like MADS-box protein AGL66 | ||||
| Refseq | XP_011654394.1 | 5e-51 | PREDICTED: MADS-box transcription factor 18-like | ||||
| Swissprot | Q9LM46 | 2e-42 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | A0A1S3B5T1 | 1e-49 | A0A1S3B5T1_CUCME; agamous-like MADS-box protein AGL66 | ||||
| STRING | XP_008442144.1 | 2e-50 | (Cucumis melo) | ||||
| STRING | XP_004146412.1 | 1e-50 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 1e-42 | AGAMOUS-like 104 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




