 |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C009309P3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 125aa MW: 13882.9 Da PI: 7.2583 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 182.3 | 3.9e-57 | 24 | 116 | 1 | 93 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl+kyre+
MELO3C009309P3 24 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKTYLTKYREV 116
69*****************************************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.4E-53 | 19 | 116 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 4.04E-39 | 27 | 116 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.0E-29 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.5E-21 | 58 | 76 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.5E-21 | 77 | 95 | No hit | No description |
| PRINTS | PR00615 | 1.5E-21 | 96 | 114 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MADAPASPGG GSHESGEQSP RSNVREQDRF LPIANISRIM KKALPANGKI AKDAKETVQE 60 CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKTYL TKYREVVIRL 120 VLMF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 1e-47 | 23 | 115 | 1 | 93 | NF-YB |
| 4awl_B | 1e-47 | 23 | 115 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-47 | 23 | 115 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG003875 | 0.0 | HG003875.1 Cucumis sativus mRNA for nuclear transcription factor Y subunit B-8-like, cultivar Summer Green. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016899739.1 | 4e-83 | PREDICTED: nuclear transcription factor Y subunit B isoform X3 | ||||
| Refseq | XP_022935570.1 | 3e-82 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_022935571.1 | 3e-82 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_022983506.1 | 3e-82 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_022983507.1 | 3e-82 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_023529112.1 | 3e-82 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_023529113.1 | 3e-82 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Swissprot | Q8VYK4 | 2e-66 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A0A0LAB9 | 7e-81 | A0A0A0LAB9_CUCSA; Uncharacterized protein | ||||
| TrEMBL | A0A1S3B5N5 | 7e-81 | A0A1S3B5N5_CUCME; nuclear transcription factor Y subunit B-1 isoform X1 | ||||
| TrEMBL | A0A1S4DUT1 | 1e-81 | A0A1S4DUT1_CUCME; nuclear transcription factor Y subunit B isoform X3 | ||||
| STRING | XP_008442637.1 | 1e-81 | (Cucumis melo) | ||||
| STRING | XP_004137802.1 | 1e-81 | (Cucumis sativus) | ||||
| STRING | XP_004169107.1 | 1e-81 | (Cucumis sativus) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 7e-69 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||
| ©2010-2022, Center
for Bioinformatics, Peking University Last Modified: 2022-12-08 Questions or Comments, please contact  |
Supported By
|