![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C009327P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 77aa MW: 8324.95 Da PI: 10.6608 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 134.5 | 2.5e-42 | 10 | 76 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+ veakG+nP livll+vgglll+flvgny+ly yaqknlPP+kkkPvskkk+kre+lkqGv++PGe
MELO3C009327P1 10 NDVEAKGFNPALIVLLLVGGLLLTFLVGNYALYLYAQKNLPPKKKKPVSKKKMKRERLKQGVSAPGE 76
789***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 1.0E-4 | 9 | 76 | No hit | No description |
| Pfam | PF04689 | 9.1E-40 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MASEQGNVIN DVEAKGFNPA LIVLLLVGGL LLTFLVGNYA LYLYAQKNLP PKKKKPVSKK 60 KMKRERLKQG VSAPGE* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681841 | 1e-124 | LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011. | |||
| GenBank | LN713258 | 1e-124 | LN713258.1 Cucumis melo genomic chromosome, chr_4. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010104121.2 | 1e-27 | DNA-binding protein S1FA | ||||
| Refseq | XP_024026346.1 | 1e-27 | DNA-binding protein S1FA | ||||
| Swissprot | Q42337 | 3e-16 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | W9SCA3 | 3e-28 | W9SCA3_9ROSA; DNA-binding protein S1FA1 | ||||
| STRING | XP_010104121.1 | 5e-29 | (Morus notabilis) | ||||




