![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C011296P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 97aa MW: 10777.1 Da PI: 9.2112 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 55.3 | 1.3e-17 | 63 | 96 | 1 | 34 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT--- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpv 34
++Dgy+WrKYGqK k+++ pr+Y++C+s+gCpv
MELO3C011296P1 63 VKDGYKWRKYGQKITKDNQSPRAYFKCSSPGCPV 96
58******************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.7E-16 | 55 | 96 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 17.144 | 58 | 96 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.75E-15 | 59 | 96 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.0E-6 | 63 | 96 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.9E-12 | 64 | 96 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 97 aa Download sequence Send to blast |
MLKVVSIKNL VSQVDVCSRD HDQNDEGSRS ERADLRVSPP TLETSSTTQA YATTSFKDQA 60 LMVKDGYKWR KYGQKITKDN QSPRAYFKCS SPGCPV* |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681823 | 2e-97 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
| GenBank | LN713257 | 2e-97 | LN713257.1 Cucumis melo genomic chromosome, chr_3. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016899977.1 | 5e-67 | PREDICTED: probable WRKY transcription factor 40 | ||||
| TrEMBL | A0A1S4DVG5 | 1e-65 | A0A1S4DVG5_CUCME; probable WRKY transcription factor 40 | ||||
| STRING | XP_008445263.1 | 3e-66 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF7398 | 30 | 44 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G31800.2 | 8e-17 | WRKY DNA-binding protein 18 | ||||




