![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C011409P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 152aa MW: 17812.3 Da PI: 10.12 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 99.3 | 1.5e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskR++g+lKKA+E+SvLCdaeva+i+fs++gkl+eyss
MELO3C011409P1 9 KRIENKINRQVTFSKRKAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYSS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 76.4 | 7.6e-26 | 85 | 149 | 9 | 73 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73
++ +e+++ e+ +Lk+++e Lqr++ h++GedL+sLs+keLq+Leqq++++lk++Rs+K +++
MELO3C011409P1 85 ESHFSHENWTLEYYRLKSKVELLQRNNSHYVGEDLDSLSVKELQNLEQQIDTALKHVRSRKVRVF 149
556679*******************************************************9886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.085 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.1E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.68E-41 | 2 | 74 | No hit | No description |
| SuperFamily | SSF55455 | 1.31E-34 | 2 | 88 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.8E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.2E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 6.9E-21 | 86 | 149 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 12.533 | 90 | 151 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 152 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRKAGLLK KAHEISVLCD AEVALIVFSH KGKLFEYSSD 60 SSMEKILERY ERYSFVGRQQ NAASESHFSH ENWTLEYYRL KSKVELLQRN NSHYVGEDLD 120 SLSVKELQNL EQQIDTALKH VRSRKVRVFF Y* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 3e-24 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 3e-24 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 3e-24 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 3e-24 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that promotes early floral meristem identity in synergy with LEAFY. Displays a redundant function with CAULIFLOWER in the up-regulation of LEAFY. Required subsequently for the transition of an inflorescence meristem into a floral meristem, and for the normal development of sepals and petals in flowers. Regulates positively B class homeotic proteins (By similarity). {ECO:0000250}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By cold shock (e.g. from 22/17 to 16/12 degrees Celsius in light/night respectively). {ECO:0000269|PubMed:18332227}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681823 | 2e-98 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
| GenBank | LN713257 | 2e-98 | LN713257.1 Cucumis melo genomic chromosome, chr_3. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008445435.1 | 1e-102 | PREDICTED: truncated transcription factor CAULIFLOWER A | ||||
| Swissprot | B4YPW6 | 6e-78 | AP1A_BRAOA; Floral homeotic protein APETALA 1 A | ||||
| Swissprot | Q8GTF5 | 6e-78 | AP1A_BRAOB; Floral homeotic protein APETALA 1 A | ||||
| Swissprot | Q96356 | 6e-78 | 2AP1_BRAOT; Floral homeotic protein APETALA 1-2 | ||||
| TrEMBL | A0A1S3BCQ3 | 1e-101 | A0A1S3BCQ3_CUCME; truncated transcription factor CAULIFLOWER A | ||||
| STRING | XP_008445435.1 | 1e-102 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF588 | 32 | 119 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69120.1 | 7e-80 | MIKC_MADS family protein | ||||




