![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C014426P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 62aa MW: 7115.16 Da PI: 9.0387 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 34.1 | 9.5e-11 | 21 | 61 | 2 | 42 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfd 42
+++k sk+ T++g+ d v l a++a+rf+d+qd+LG++
MELO3C014426P1 21 TARKYHCSKVFTAKGPLDHDVKLLAHTAIRFYDVQDRLGYK 61
6788899********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 12.53 | 20 | 61 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 9.8E-8 | 22 | 61 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
MKTNTYDEIV LVQDSHILYS TARKYHCSKV FTAKGPLDHD VKLLAHTAIR FYDVQDRLGY 60 K* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}. | |||||
| UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3'. {ECO:0000269|PubMed:12000681}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681842 | 2e-99 | LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022. | |||
| GenBank | LN713259 | 2e-99 | LN713259.1 Cucumis melo genomic chromosome, chr_5. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022989259.1 | 2e-19 | transcription factor TCP10-like | ||||
| Swissprot | A2WM14 | 4e-16 | PCF5_ORYSI; Transcription factor PCF5 | ||||
| Swissprot | Q8LT07 | 4e-16 | PCF5_ORYSJ; Transcription factor PCF5 | ||||
| TrEMBL | A0A2R6QXG8 | 8e-17 | A0A2R6QXG8_ACTCH; Transcription factor like | ||||
| TrEMBL | C6TEY2 | 7e-17 | C6TEY2_SOYBN; Uncharacterized protein (Fragment) | ||||
| STRING | VIT_12s0028g02520.t01 | 2e-16 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF24944 | 2 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G31070.1 | 2e-18 | TCP domain protein 10 | ||||




