![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C017171P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 97aa MW: 10655.8 Da PI: 8.2309 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 102.6 | 2.6e-32 | 28 | 85 | 2 | 60 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
++vrY eC+kNhAa+lGg avDGC+Efm+ ge+gt +al+CaACgCHRnFHRrev+ e
MELO3C017171P1 28 SEVRYAECQKNHAAKLGGFAVDGCREFMAR-GEDGTEEALNCAACGCHRNFHRREVDAE 85
579**************************8.999*********************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 5.0E-27 | 1 | 94 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 1.3E-29 | 30 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 8.4E-27 | 31 | 82 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.362 | 32 | 81 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0048509 | Biological Process | regulation of meristem development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 97 aa Download sequence Send to blast |
MKKRLVVVKK SDGSNGRRNH HWSASSGSEV RYAECQKNHA AKLGGFAVDG CREFMARGED 60 GTEEALNCAA CGCHRNFHRR EVDAEVVFEY SPPNSN* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:21455630}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681813 | 1e-162 | LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030. | |||
| GenBank | LN713256 | 1e-162 | LN713256.1 Cucumis melo genomic chromosome, chr_2. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008453204.1 | 3e-66 | PREDICTED: mini zinc finger protein 3-like | ||||
| Swissprot | Q2Q493 | 6e-36 | MIF3_ARATH; Mini zinc finger protein 3 | ||||
| TrEMBL | A0A1S3BWG1 | 7e-65 | A0A1S3BWG1_CUCME; mini zinc finger protein 3-like | ||||
| STRING | XP_008453204.1 | 1e-65 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1550 | 34 | 100 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G18835.1 | 2e-38 | mini zinc finger | ||||




