![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C019620P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 163aa MW: 19017.9 Da PI: 10.2724 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 182.3 | 1.2e-56 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93
lppGfrFhPtdeelv +yL +k++g+++el e+i+e+d+yk+ePw+Lp k + +++ ewyf+s+rd+ky++g+r+nratk gyWkatgkd+ v
MELO3C019620P1 6 LPPGFRFHPTDEELVAYYLDRKINGRSIEL-EIIPEIDLYKCEPWELPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATKGGYWKATGKDRVVQ 99
79****************************.99**************96435566888**********************************999 PP
NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
s ++++vg+kktLv+ykgrap+g++t+Wvmheyrl
MELO3C019620P1 100 S-QKRAVGMKKTLVYYKGRAPHGVRTNWVMHEYRL 133
9.9999***************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 5.62E-62 | 3 | 138 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 56.344 | 6 | 156 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.9E-30 | 7 | 133 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MAPMTLPPGF RFHPTDEELV AYYLDRKING RSIELEIIPE IDLYKCEPWE LPDKSFLPSK 60 DMEWYFYSPR DRKYPNGSRT NRATKGGYWK ATGKDRVVQS QKRAVGMKKT LVYYKGRAPH 120 GVRTNWVMHE YRLLHSQLAT AATSSPSTKV FFLFHSHFRV RV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 2e-56 | 1 | 143 | 12 | 152 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-56 | 1 | 143 | 12 | 152 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-56 | 1 | 143 | 12 | 152 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-56 | 1 | 143 | 12 | 152 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-56 | 1 | 143 | 15 | 155 | NAC domain-containing protein 19 |
| 3swm_B | 2e-56 | 1 | 143 | 15 | 155 | NAC domain-containing protein 19 |
| 3swm_C | 2e-56 | 1 | 143 | 15 | 155 | NAC domain-containing protein 19 |
| 3swm_D | 2e-56 | 1 | 143 | 15 | 155 | NAC domain-containing protein 19 |
| 3swp_A | 2e-56 | 1 | 143 | 15 | 155 | NAC domain-containing protein 19 |
| 3swp_B | 2e-56 | 1 | 143 | 15 | 155 | NAC domain-containing protein 19 |
| 3swp_C | 2e-56 | 1 | 143 | 15 | 155 | NAC domain-containing protein 19 |
| 3swp_D | 2e-56 | 1 | 143 | 15 | 155 | NAC domain-containing protein 19 |
| 4dul_A | 2e-56 | 1 | 143 | 12 | 152 | NAC domain-containing protein 19 |
| 4dul_B | 2e-56 | 1 | 143 | 12 | 152 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00205 | DAP | Transfer from AT1G54330 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681921 | 0.0 | LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039. | |||
| GenBank | LN713265 | 0.0 | LN713265.1 Cucumis melo genomic chromosome, chr_11. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008456283.1 | 1e-108 | PREDICTED: NAC domain-containing protein 76 | ||||
| Swissprot | Q9FFI5 | 5e-81 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
| TrEMBL | A0A1S3C450 | 1e-106 | A0A1S3C450_CUCME; NAC domain-containing protein 76 | ||||
| STRING | XP_008456283.1 | 1e-107 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10508 | 33 | 41 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54330.1 | 3e-85 | NAC domain containing protein 20 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




