PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MELO3C022002P1

Organism

Cucumis melo

Taxonomic ID

3656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

NAC

Protein Properties

Length: 324aa MW: 36223.7 Da PI: 8.0768

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C022002P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	176.8	5.9e-55	24	149	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeel+++yL +kv + +++ +i ++d++k+ePwdLp ++k +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkdke+++ MELO3C022002P1 24 LPPGFRFHPTDEELITHYLSPKVLNPNFSS-IAIGHADLNKSEPWDLPGRAKMGEKEWYFFCVKDRKYPTGLRTNRATDSGYWKATGKDKEIFR- 116 79***********************999.78***********99999*************************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +++lvg+kktLvfykgrapkgek++Wvmhe+rl MELO3C022002P1 117 GKKLVGMKKTLVFYKGRAPKGEKSNWVMHEFRL 149 99***************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.97E-63	14	171	IPR003441	NAC domain
PROSITE profile	PS51005	58.882	24	171	IPR003441	NAC domain
Pfam	PF02365	4.4E-29	25	149	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0010029	Biological Process	regulation of seed germination
GO:0042542	Biological Process	response to hydrogen peroxide
GO:0043068	Biological Process	positive regulation of programmed cell death
GO:0048527	Biological Process	lateral root development
GO:0051091	Biological Process	positive regulation of sequence-specific DNA binding transcription factor activity
GO:0090400	Biological Process	stress-induced premature senescence
GO:1900057	Biological Process	positive regulation of leaf senescence
GO:1902074	Biological Process	response to salt
GO:1904250	Biological Process	positive regulation of age-related resistance
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 324 aa Download sequence Send to blast
MAETQTQTNN FWNHTNNEEQ QIDLPPGFRF HPTDEELITH YLSPKVLNPN FSSIAIGHAD 60 LNKSEPWDLP GRAKMGEKEW YFFCVKDRKY PTGLRTNRAT DSGYWKATGK DKEIFRGKKL 120 VGMKKTLVFY KGRAPKGEKS NWVMHEFRLQ PKFIIKPTTK NEWVICRIFN KSSTESKLLP 180 SITMNNNPFN SPALPALMEY SQSQTPYTGE ARAASHVSCF SNDGGGGGGG GGDTKLYNFR 240 TNTYNHHFSS SSALPPAPAL LPFPLPNTAD SGYGNSIMRM LMNPKVEISG YSTNGIGMME 300 GDDDQNPSLV SDDPLDLESL WNY*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	8e-55	21	177	14	171	NO APICAL MERISTEM PROTEIN
1ut4_B	8e-55	21	177	14	171	NO APICAL MERISTEM PROTEIN
1ut7_A	8e-55	21	177	14	171	NO APICAL MERISTEM PROTEIN
1ut7_B	8e-55	21	177	14	171	NO APICAL MERISTEM PROTEIN
4dul_A	8e-55	21	177	14	171	NAC domain-containing protein 19
4dul_B	8e-55	21	177	14	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00535	DAP	Transfer from AT5G39610	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681889	0.0	LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBank	LN713263	0.0	LN713263.1 Cucumis melo genomic chromosome, chr_9.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008459335.1	0.0	PREDICTED: NAC domain-containing protein 92-like isoform X2
Swissprot	Q9FKA0	7e-96	NAC92_ARATH; NAC domain-containing protein 92
TrEMBL	A0A1S3C9F2	0.0	A0A1S3C9F2_CUCME; NAC domain-containing protein 92-like isoform X2
STRING	XP_008459334.1	0.0	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF24620	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39610.1	2e-98	NAC domain containing protein 6

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]