![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C022205P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 113aa MW: 12803 Da PI: 10.4328 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 80.8 | 9e-26 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien rqvtf+kRr+g+lKKA+ELSvLCdae+ + ifs +gklye +
MELO3C022205P1 9 KRIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLFIFSAHGKLYELA 58
79*********************************************965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.9E-35 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.18E-28 | 1 | 76 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.787 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.50E-40 | 2 | 76 | No hit | No description |
| PRINTS | PR00404 | 1.3E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.2E-23 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0048364 | Biological Process | root development | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
MARGKVQMKR IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLFIFSA HGKLYELATK 60 GTMQGLIERY MKHTNGNQPP DPPIHHQTSE AKEEIIRLKQ EIEVLKGLRL NT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 7e-19 | 1 | 91 | 1 | 87 | MEF2C |
| 5f28_B | 7e-19 | 1 | 91 | 1 | 87 | MEF2C |
| 5f28_C | 7e-19 | 1 | 91 | 1 | 87 | MEF2C |
| 5f28_D | 7e-19 | 1 | 91 | 1 | 87 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681889 | 8e-97 | LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051. | |||
| GenBank | LN713263 | 8e-97 | LN713263.1 Cucumis melo genomic chromosome, chr_9. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016902413.1 | 1e-75 | PREDICTED: agamous-like MADS-box protein AGL12 | ||||
| Swissprot | Q38841 | 2e-43 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
| TrEMBL | A0A1S4E2G4 | 3e-74 | A0A1S4E2G4_CUCME; agamous-like MADS-box protein AGL12 | ||||
| STRING | XP_008459723.1 | 1e-74 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF7566 | 31 | 44 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71692.1 | 7e-46 | AGAMOUS-like 12 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




