PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MELO3C022542P1

Organism

Cucumis melo

Taxonomic ID

3656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

G2-like

Protein Properties

Length: 77aa MW: 8750.26 Da PI: 11.6163

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C022542P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	96	2.8e-30	21	72	2	53
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 prlrWtp+LH++Fv a+e+LGG++kAtPk +l+lm+vkgLt++hvkSHLQ + MELO3C022542P1 21 PRLRWTPDLHHSFVLAIERLGGHQKATPKLVLQLMDVKGLTISHVKSHLQVF 72 8*************************************************87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.4E-28	17	72	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.23E-15	19	74	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	4.3E-23	21	73	IPR006447	Myb domain, plants
Pfam	PF00249	2.9E-7	22	71	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 77 aa Download sequence Send to blast
MSSNSCGRNG SVRQYIRSKV PRLRWTPDLH HSFVLAIERL GGHQKATPKL VLQLMDVKGL 60 TISHVKSHLQ VFFFFF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	1e-18	22	72	4	54	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	1e-18	22	72	4	54	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A	1e-18	22	72	3	53	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	1e-18	22	72	3	53	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	1e-18	22	72	3	53	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	1e-18	22	72	3	53	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	1e-18	22	72	4	54	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	1e-18	22	72	4	54	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	1e-18	22	72	4	54	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	1e-18	22	72	4	54	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	1e-18	22	72	4	54	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	1e-18	22	72	4	54	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681904	9e-68	LN681904.1 Cucumis melo genomic scaffold, anchoredscaffold00053.
GenBank	LN713264	9e-68	LN713264.1 Cucumis melo genomic chromosome, chr_10.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016902518.1	7e-45	PREDICTED: putative Myb family transcription factor At1g14600
Swissprot	Q700D9	5e-28	MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBL	A0A1S4E2S3	2e-43	A0A1S4E2S3_CUCME; putative Myb family transcription factor At1g14600
STRING	XP_008460208.1	4e-44	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5539	33	53

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G14600.1	2e-30	G2-like family protein