![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C023104P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 103aa MW: 11818.4 Da PI: 5.8953 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 79.7 | 4.6e-25 | 40 | 100 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
Fl+k+y+++ed+ ++++isw+++g++fvv+++ efak++Lpk Fkhsnf+SFvRQL +F
MELO3C023104P1 40 FLMKTYRMVEDPGTDDVISWNSDGTAFVVWQTAEFAKDILPKLFKHSNFSSFVRQLIPMDF 100
9*******************************************************87777 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.0E-26 | 31 | 100 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 5.8E-15 | 36 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.18E-21 | 39 | 101 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 9.1E-21 | 40 | 100 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.7E-14 | 40 | 63 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.7E-14 | 78 | 90 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 2.7E-14 | 91 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MEAGVSDNNN NRNEEKKLES WPPWKAESEI RMRKSTTAPF LMKTYRMVED PGTDDVISWN 60 SDGTAFVVWQ TAEFAKDILP KLFKHSNFSS FVRQLIPMDF GK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5w_B | 3e-19 | 37 | 102 | 1 | 66 | Putative transcription factor |
| 5d5x_B | 3e-19 | 37 | 102 | 1 | 66 | Putative transcription factor |
| 5d5x_E | 3e-19 | 37 | 102 | 1 | 66 | Putative transcription factor |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. | |||||
| UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:9645433}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681880 | 1e-163 | LN681880.1 Cucumis melo genomic scaffold, anchoredscaffold00058. | |||
| GenBank | LN713262 | 1e-163 | LN713262.1 Cucumis melo genomic chromosome, chr_8. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008460754.2 | 7e-60 | PREDICTED: heat stress transcription factor B-3 | ||||
| Swissprot | P22335 | 4e-27 | HSF24_SOLPE; Heat shock factor protein HSF24 | ||||
| Swissprot | Q96320 | 3e-27 | HSFB1_ARATH; Heat stress transcription factor B-1 | ||||
| TrEMBL | A0A1S3CD46 | 2e-58 | A0A1S3CD46_CUCME; heat stress transcription factor B-3 | ||||
| STRING | XP_008460754.1 | 3e-59 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36990.1 | 1e-29 | heat shock factor 4 | ||||




