![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C025504P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 103aa MW: 11653.8 Da PI: 9.6206 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 74.5 | 2e-23 | 16 | 82 | 1 | 67 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAea 67
+CaaCk+lrrkC+++C+lapyfp ++p kfa+vh+++Ga nv+k+ ++lpe e++++++ y ++
MELO3C025504P1 16 PCAACKILRRKCVDNCILAPYFPPTDPLKFAAVHRIYGAGNVIKFFQELPERVGERMLRAVWYTKRM 82
7************************************************************998665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 15.822 | 15 | 102 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 6.7E-22 | 16 | 83 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
NTMQSPPPPC TVVLSPCAAC KILRRKCVDN CILAPYFPPT DPLKFAAVHR IYGAGNVIKF 60 FQELPERVGE RMLRAVWYTK RMQESETQSM GALVQYFNFK IK* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 9e-20 | 15 | 93 | 10 | 90 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 9e-20 | 15 | 93 | 10 | 90 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN681891 | 1e-100 | LN681891.1 Cucumis melo genomic scaffold, anchoredscaffold00079. | |||
| GenBank | LN713263 | 1e-100 | LN713263.1 Cucumis melo genomic chromosome, chr_9. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022939142.1 | 4e-30 | LOB domain-containing protein 1-like | ||||
| Swissprot | Q9SK08 | 3e-27 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
| TrEMBL | A0A0A0KU20 | 1e-34 | A0A0A0KU20_CUCSA; Uncharacterized protein | ||||
| STRING | XP_004173617.1 | 7e-36 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1303 | 34 | 106 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G28500.1 | 1e-29 | LOB domain-containing protein 11 | ||||




