![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MELO3C027202P1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 57aa MW: 6519.42 Da PI: 6.7626 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 30.1 | 1e-09 | 6 | 52 | 17 | 63 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
A+rsR RK+++i+eLe+ v++L+a ++ ele l+++ l +e+
MELO3C027202P1 6 AQRSRVRKLQYIAELERNVQALQANGSEVSAELEFLSQQNLILGMEN 52
89************************************999888887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| CDD | cd14703 | 1.84E-11 | 4 | 45 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 1.7E-9 | 6 | 48 | No hit | No description |
| SuperFamily | SSF57959 | 9.14E-7 | 6 | 48 | No hit | No description |
| Pfam | PF00170 | 1.4E-6 | 6 | 48 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 57 aa Download sequence Send to blast |
MDVQFAQRSR VRKLQYIAEL ERNVQALQAN GSEVSAELEF LSQQNLILGM ENKAPKQ |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | LN682504 | 5e-87 | LN682504.1 Cucumis melo genomic scaffold, unanchored_scaffold00650. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004135341.1 | 1e-26 | PREDICTED: uncharacterized protein At4g06598 isoform X1 | ||||
| Refseq | XP_011655547.1 | 1e-26 | PREDICTED: uncharacterized protein At4g06598 isoform X2 | ||||
| TrEMBL | A0A0A0KPT7 | 3e-25 | A0A0A0KPT7_CUCSA; Uncharacterized protein | ||||
| TrEMBL | A0A438GVP9 | 2e-25 | A0A438GVP9_VITVI; Basic leucine zipper 34 | ||||
| STRING | XP_004161923.1 | 5e-26 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5123 | 26 | 37 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G58110.2 | 4e-24 | bZIP family protein | ||||




