PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_10725.2

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

bZIP

Protein Properties

Length: 127aa MW: 14116.2 Da PI: 10.3966

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_10725.2	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	36	1.6e-11	48	106	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 kr +r NR +A rs +RK +i eLe+kv+ L++e ++L+ +l+ l+ +a++ +++ MLOC_10725.2 48 KRVKRVLANRQSAARSKERKMRYIVELEQKVQILQTEATTLAAQLNLLQRDSATVATQN 106 999*********************************************99998877765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	5.5E-17	44	108	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.576	46	109	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.13E-11	48	98	No hit	No description
Gene3D	G3DSA:1.20.5.170	2.3E-11	48	101	No hit	No description
Pfam	PF00170	1.6E-10	48	106	IPR004827	Basic-leucine zipper domain
CDD	cd14703	4.29E-18	49	100	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 127 aa Download sequence Send to blast
MGRLNFASPG GAAGMFSLEF GSAEFSPAEM KKIMADEKLA EMALADPKRV KRVLANRQSA 60 ARSKERKMRY IVELEQKVQI LQTEATTLAA QLNLLQRDSA TVATQNNELR FRLQAMEQQA 120 QLRDGAS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269\|PubMed:27896439}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_10725.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT035229	1e-108	BT035229.1 Zea mays full-length cDNA clone ZM_BFb0046N14 mRNA, complete cds.
GenBank	JX469926	1e-108	JX469926.1 Zea mays subsp. mays clone UT3184 bZIP-type transcription factor mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020177375.1	1e-71	transcription factor RF2b-like
Swissprot	O22873	5e-40	BZP18_ARATH; bZIP transcription factor 18
TrEMBL	A0A287PW43	3e-84	A0A287PW43_HORVV; Uncharacterized protein
STRING	MLOC_10725.1	3e-83	(Hordeum vulgare)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38900.3	3e-44	bZIP family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Pawar V, et al. A novel family of plant nuclear envelope-associated proteins. J. Exp. Bot., 2016. 67(19): p. 5699-5710 [PMID:27630107] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S Efficient gene tagging in Arabidopsis thaliana using a gene trap approach. Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7 [PMID:9356517]