PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_11453.2

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

HSF

Protein Properties

Length: 104aa MW: 11341.1 Da PI: 7.3857

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_11453.2	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	68.4	1.6e-21	25	83	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 F+ k+y+++ d++++ l++w + +nsf+v d f++ +Lp +Fkh nf+SFvRQLn+Y MLOC_11453.2 25 FVAKTYQMVCDPRTDALVRWGKGNNSFLVPDVAGFSQLLLPCFFKHGNFSSFVRQLNTY 83 9********************************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00415	7.5E-15	21	95	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Gene3D	G3DSA:1.10.10.10	1.3E-22	21	86	IPR011991	Winged helix-turn-helix DNA-binding domain
SuperFamily	SSF46785	5.58E-21	22	93	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	1.3E-12	25	48	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	3.6E-17	25	83	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.3E-12	63	75	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.3E-12	76	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
MDSLHTELAL GLIGCGHGDF QTAPFVAKTY QMVCDPRTDA LVRWGKGNNS FLVPDVAGFS 60 QLLLPCFFKH GNFSSFVRQL NTYVSTPILP SEASRAAVFC LVLS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5hdg_A	5e-14	25	83	10	68	Heat shock factor protein 1
5hdn_A	5e-14	25	83	10	68	Heat shock factor protein 1
5hdn_B	5e-14	25	83	10	68	Heat shock factor protein 1
5hdn_C	5e-14	25	83	10	68	Heat shock factor protein 1
5hdn_D	5e-14	25	83	10	68	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_11453.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG670306	1e-143	HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020162679.1	6e-53	heat stress transcription factor C-1a-like
Swissprot	Q6VBA4	3e-45	HFC1A_ORYSJ; Heat stress transcription factor C-1a
TrEMBL	A0A446NIG4	3e-67	A0A446NIG4_TRITD; Uncharacterized protein
STRING	MLOC_11453.1	2e-55	(Hordeum vulgare)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24520.1	8e-26	heat shock transcription factor C1

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]