![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_11474.4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 104aa MW: 11826 Da PI: 10.6231 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 70.4 | 1.6e-22 | 10 | 53 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
+ en+s rqvt+skRr gilKKA+ELS+LCd++ +++fs++g+
MLOC_11474.4 10 KLENSSGRQVTYSKRRSGILKKAKELSILCDIDLILLMFSPSGR 53
679**************************************995 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 5.2E-29 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 24.6 | 1 | 53 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.96E-26 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.8E-18 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.5E-20 | 11 | 54 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.8E-18 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.8E-18 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010152 | Biological Process | pollen maturation | ||||
| GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 104 aa Download sequence Send to blast |
MGRVKLKIKK LENSSGRQVT YSKRRSGILK KAKELSILCD IDLILLMFSP SGRPTICIGD 60 KSPIDEVIAK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
| 6byy_B | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
| 6byy_C | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
| 6byy_D | 1e-14 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_11474.4 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK373111 | 1e-174 | AK373111.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3021H04. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020192405.1 | 6e-64 | agamous-like MADS-box protein AGL65 | ||||
| Swissprot | Q7X9I0 | 3e-50 | AGL65_ARATH; Agamous-like MADS-box protein AGL65 | ||||
| TrEMBL | A0A287NR03 | 2e-68 | A0A287NR03_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_11474.1 | 1e-66 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G18750.1 | 5e-42 | AGAMOUS-like 65 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




