![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_12609.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | Nin-like | ||||||||
| Protein Properties | Length: 57aa MW: 6618.1 Da PI: 11.0492 | ||||||||
| Description | Nin-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | RWP-RK | 69.8 | 3.7e-22 | 1 | 37 | 16 | 52 |
RWP-RK 16 lpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
+pik AA eL+v+lT+LK++CR+ GI+RWPhRk+ksl
MLOC_12609.2 1 MPIKRAAEELNVGLTILKKRCREIGIPRWPHRKVKSL 37
79*********************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51519 | 14.311 | 1 | 57 | IPR003035 | RWP-RK domain |
| Pfam | PF02042 | 4.3E-18 | 1 | 37 | IPR003035 | RWP-RK domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 57 aa Download sequence Send to blast |
MPIKRAAEEL NVGLTILKKR CREIGIPRWP HRKVKSLETL IKNAQVFLLI CVSFLFV |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_12609.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025822796.1 | 2e-21 | protein RKD1 | ||||
| Swissprot | Q9LVU8 | 3e-18 | RKD4_ARATH; Protein RKD4 | ||||
| TrEMBL | A0A287UQZ0 | 3e-33 | A0A287UQZ0_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_12609.1 | 1e-23 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53040.1 | 1e-20 | RWP-RK domain-containing protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




