![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_13062.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 59aa MW: 6344.96 Da PI: 8.5177 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 38.8 | 2.2e-12 | 23 | 58 | 1 | 37 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37
rg W + Ede+l ++v+++G+ +W++Ia+++ gR++
MLOC_13062.3 23 RGHWRPGEDEKLRQLVEKYGPQNWNSIAEKLE-GRSG 58
899*****************************.**96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 15.677 | 18 | 59 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 7.9E-10 | 21 | 58 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 4.3E-13 | 22 | 58 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 2.5E-11 | 23 | 58 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 9.85E-10 | 26 | 58 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 59 aa Download sequence Send to blast |
MAASSSTTNT SEGGAKPSSL CPRGHWRPGE DEKLRQLVEK YGPQNWNSIA EKLEGRSGG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. | |||||
| UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_13062.3 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. | |||||
| UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF951910 | 2e-65 | JF951910.1 Triticum aestivum clone TaMYB27 R2R3-MYB protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020156227.1 | 5e-34 | transcription factor RAX1-like | ||||
| Swissprot | Q5NBM8 | 3e-16 | CSA_ORYSJ; Transcription factor CSA | ||||
| Swissprot | Q6R0C4 | 2e-16 | MYB52_ARATH; Transcription factor MYB52 | ||||
| TrEMBL | M0UQA5 | 3e-35 | M0UQA5_HORVV; Uncharacterized protein | ||||
| STRING | Traes_4BS_189002AB8.1 | 2e-33 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G17950.1 | 7e-19 | myb domain protein 52 | ||||




