PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_16746.1

Common Name

WRKY48

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

WRKY

Protein Properties

Length: 96aa MW: 10857.2 Da PI: 9.5346

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_16746.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	66	6.1e-21	42	96	2	57
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--S CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHn 57 +Dgy+W+KYGqK +k+ + rsY+rC ++C +kkkve + dp+ + ++Y g H+ MLOC_16746.1 42 EDGYQWKKYGQKFIKNIQKIRSYFRCRDRRCGAKKKVEWQPGDPS-LRVVYDGAHQ 96 7**************************************9987.5899**96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50811	15.996	36	96	IPR003657	WRKY domain
SuperFamily	SSF118290	2.75E-19	38	95	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	1.2E-21	39	96	IPR003657	WRKY domain
SMART	SM00774	5.0E-16	41	96	IPR003657	WRKY domain
Pfam	PF03106	1.0E-19	42	96	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
MASTSQPAMA TAGSGHGDEQ VQRQATWPEE ADGGSQPLVM PEDGYQWKKY GQKFIKNIQK 60 IRSYFRCRDR RCGAKKKVEW QPGDPSLRVV YDGAHQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_16746.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ806389	1e-160	JQ806389.1 Hordeum vulgare WRKY transcript factor 48 (WRKY48) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020162458.1	4e-48	WRKY transcription factor WRKY24-like isoform X2
Refseq	XP_020181478.1	4e-48	WRKY transcription factor WRKY24-like isoform X2
Swissprot	Q9C983	4e-13	WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBL	A0A287MXE0	1e-65	A0A287MXE0_HORVV; Uncharacterized protein
TrEMBL	K7R129	1e-65	K7R129_HORVU; WRKY transcript factor 48
STRING	MLOC_16746.1	1e-66	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP10158	34	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69310.2	2e-15	WRKY DNA-binding protein 57

Publications ? help Back to Top
Meng Y,Wise RP HvWRKY10, HvWRKY19, and HvWRKY28 regulate Mla-triggered immunity and basal defense to barley powdery mildew. Mol. Plant Microbe Interact., 2012. 25(11): p. 1492-505 [PMID:22809275] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jiang Y,Qiu Y,Hu Y,Yu D Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa. Front Plant Sci, 2016. 7: p. 145 [PMID:26904091] Jiang Y,Yu D The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]