![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_18177.7 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10227.8 Da PI: 9.8232 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 62.4 | 9.1e-20 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg W++eEde+lv++++ +G g+W++++r g+ R++k+c++rw +yl
MLOC_18177.7 14 RGLWSPEEDEKLVKYITAHGHGCWSSVPRQAGLQRCGKSCRLRWINYL 61
789*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.3E-28 | 6 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.785 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 7.3E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.1E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.08E-22 | 16 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 9.21E-11 | 17 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 8.758 | 66 | 88 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0009834 | Biological Process | plant-type secondary cell wall biogenesis | ||||
| GO:0009901 | Biological Process | anther dehiscence | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MGHHSCCNKQ KVRRGLWSPE EDEKLVKYIT AHGHGCWSSV PRQAGLQRCG KSCRLRWINY 60 LRPDLKRGSF SQEEEALIVE LHRVLGNR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-15 | 14 | 88 | 7 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_18177.7 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK372926 | 1e-147 | AK372926.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3016B12. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001148338.1 | 1e-61 | uncharacterized protein LOC100281948 | ||||
| Swissprot | Q9SPG3 | 6e-52 | MYB26_ARATH; Transcription factor MYB26 | ||||
| TrEMBL | B6T169 | 2e-60 | B6T169_MAIZE; MYB9 | ||||
| STRING | GRMZM2G088783_P01 | 4e-61 | (Zea mays) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G13890.2 | 1e-57 | myb domain protein 26 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




