PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_19031.1

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

WRKY

Protein Properties

Length: 94aa MW: 10642.1 Da PI: 10.3851

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_19031.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	105.1	3.6e-33	34	89	3	58
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 Dgy+WrKYGqK +k++++prsYY+Ctsa+C++kk+ve+s++dp+++++tYeg+H h MLOC_19031.1 34 DGYRWRKYGQKFIKNNPHPRSYYKCTSARCSAKKHVEKSTDDPEMLIVTYEGSHLH 89 9*****************************************************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	9.3E-32	29	90	IPR003657	WRKY domain
SuperFamily	SSF118290	1.27E-27	31	91	IPR003657	WRKY domain
SMART	SM00774	2.9E-36	32	91	IPR003657	WRKY domain
PROSITE profile	PS50811	28.013	34	92	IPR003657	WRKY domain
Pfam	PF03106	9.9E-28	34	89	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
CLKSRRYGAP GTAPESRHVT KVRSCGGGKK TPMDGYRWRK YGQKFIKNNP HPRSYYKCTS 60 ARCSAKKHVE KSTDDPEMLI VTYEGSHLHG PQTT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-22	34	89	19	74	Probable WRKY transcription factor 4
2lex_A	1e-22	34	89	19	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_19031.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ863130	1e-152	DQ863130.1 Hordeum vulgare WRKY transcription factor 36 (WRKY36) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020148290.1	4e-55	WRKY transcription factor WRKY24-like isoform X1
Swissprot	Q9C983	2e-23	WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBL	B2KJ86	6e-62	B2KJ86_HORVU; WRKY transcription factor 36 (Fragment)
STRING	MLOC_19031.2	4e-61	(Hordeum vulgare)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69310.2	9e-26	WRKY DNA-binding protein 57

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jiang Y,Qiu Y,Hu Y,Yu D Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa. Front Plant Sci, 2016. 7: p. 145 [PMID:26904091] Jiang Y,Yu D The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance. Plant Physiol., 2016. 171(4): p. 2771-82 [PMID:27268959] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]