![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_19666.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 70aa MW: 7637.68 Da PI: 7.5156 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 94.7 | 9.9e-30 | 1 | 66 | 35 | 100 |
Whirly 35 llelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlp 100
+l++ +a+++rkyd+ kkq fals+tev++l++l++ esceffhdp++k+s+eG+v+k+l++ Pl
MLOC_19666.1 1 MLTFFPAVGQRKYDYTKKQLFALSPTEVGSLISLGPAESCEFFHDPSMKSSHEGQVKKSLSITPLG 66
89**************************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF54447 | 2.75E-26 | 1 | 70 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 6.6E-29 | 1 | 69 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 2.4E-29 | 1 | 69 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MLTFFPAVGQ RKYDYTKKQL FALSPTEVGS LISLGPAESC EFFHDPSMKS SHEGQVKKSL 60 SITPLGSDNG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4kop_A | 2e-29 | 1 | 70 | 50 | 119 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_B | 2e-29 | 1 | 70 | 50 | 119 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_C | 2e-29 | 1 | 70 | 50 | 119 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_D | 2e-29 | 1 | 70 | 50 | 119 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_19666.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK249976 | 1e-114 | AK249976.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf60h16, mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020180430.1 | 9e-45 | single-stranded DNA-bindig protein WHY2, mitochondrial | ||||
| Swissprot | Q8VYF7 | 1e-28 | WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A287TMD0 | 8e-45 | A0A287TMD0_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A453NEI7 | 3e-44 | A0A453NEI7_AEGTS; Uncharacterized protein | ||||
| STRING | MLOC_19666.1 | 5e-45 | (Hordeum vulgare) | ||||
| STRING | Traes_6BS_0A692E6F6.1 | 2e-44 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3012 | 38 | 85 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 5e-31 | WHIRLY 2 | ||||




