PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_19666.2
Organism
Hordeum vulgare
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family Whirly
Protein Properties Length: 60aa    MW: 6695.69 Da    PI: 8.4987
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_19666.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly87.71.5e-271603594
        Whirly 35 llelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkal 94
                  +l++ +a+++rkyd+ kkq fals+tev++l++l++ esceffhdp++k+s+eG+v+k+l
  MLOC_19666.2  1 MLTFFPAVGQRKYDYTKKQLFALSPTEVGSLISLGPAESCEFFHDPSMKSSHEGQVKKSL 60
                  89********************************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF544472.35E-23160IPR009044ssDNA-binding transcriptional regulator
PfamPF085366.5E-27160IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.105.6E-26160IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MLTFFPAVGQ RKYDYTKKQL FALSPTEVGS LISLGPAESC EFFHDPSMKS SHEGQVKKSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A2e-2716050109Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_B2e-2716050109Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_C2e-2716050109Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_D2e-2716050109Single-stranded DNA-binding protein WHY2, mitochondrial
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_19666.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2499766e-96AK249976.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf60h16, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020180430.15e-37single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotQ8VYF71e-26WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A287TMD07e-37A0A287TMD0_HORVV; Uncharacterized protein
TrEMBLA0A453NEI72e-36A0A453NEI7_AEGTS; Uncharacterized protein
STRINGMLOC_19666.14e-37(Hordeum vulgare)
STRINGTraes_6AS_A92DEAA15.12e-36(Triticum aestivum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.14e-29WHIRLY 2