![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_34098.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 108aa MW: 11760.4 Da PI: 10.5239 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 121.1 | 4e-38 | 5 | 59 | 5 | 59 |
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
l+cprC s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvP+G+grrkn+
MLOC_34098.1 5 PLPCPRCRSRETKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPIGAGRRKNR 59
579**************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF02701 | 1.5E-31 | 5 | 59 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.556 | 6 | 60 | IPR003851 | Zinc finger, Dof-type |
| ProDom | PD007478 | 2.0E-25 | 6 | 59 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 8 | 44 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
AGAAPLPCPR CRSRETKFCY FNNYNVNQPR HFCKACHRYW TAGGALRNVP IGAGRRKNRP 60 LGPIATVAGH HHRAAAGFVL GFPSPSSSPT SPPPVYADRW ELGPDPPL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_34098.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ969263 | 1e-169 | AJ969263.1 Hordeum vulgare dof17 gene for dof zinc finger protein 17, cultivated variety Bomi. | |||
| GenBank | AK365055 | 1e-169 | AK365055.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2030J14. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020188982.1 | 2e-55 | dof zinc finger protein DOF1.5-like | ||||
| Swissprot | Q5JLR7 | 3e-44 | DOF5_ORYSJ; Dof zinc finger protein 5 | ||||
| TrEMBL | A0A287LMC3 | 1e-60 | A0A287LMC3_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_34098.1 | 2e-73 | (Hordeum vulgare) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6495 | 28 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29160.1 | 2e-34 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




