PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_35578.1

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

TCP

Protein Properties

Length: 74aa MW: 8266.46 Da PI: 11.0134

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_35578.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	98.6	1.1e-30	22	72	3	53
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlq 53 ++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++t+eWLl+ MLOC_35578.1 22 VAKRPTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKTDGETVEWLLE 72 689**********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	1.5E-25	27	73	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	24.206	27	74	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 74 aa Download sequence Send to blast
GGRPPNHSQS ITVAEPPSEK KVAKRPTKDR HTKVDGRGRR IRMPALCAAR VFQLTRELGH 60 KTDGETVEWL LEPA

Functional Description ? help Back to Top
Source	Description
UniProt	Can specifically bind site II elements in the promoter region of PP438/PNM1. {ECO:0000269\|PubMed:21297037}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_35578.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK361002	1e-112	AK361002.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1130G02.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020194047.1	3e-40	transcription factor PCF3-like
Swissprot	Q9C518	1e-26	TCP8_ARATH; Transcription factor TCP8
TrEMBL	F2DAT8	7e-42	F2DAT8_HORVV; Predicted protein
STRING	MLOC_35578.1	1e-47	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2864	32	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G58100.1	5e-29	TCP family protein

Publications ? help Back to Top
Mazur MJ, et al. Arabidopsis TCP Transcription Factors Interact with the SUMO Conjugating Machinery in Nuclear Foci. Front Plant Sci, 2017. 8: p. 2043 [PMID:29250092]