![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_49381.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 109aa MW: 11812.5 Da PI: 11.955 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 119.5 | 4e-37 | 9 | 93 | 6 | 91 |
TCP 6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaa 91
r+ ++hTkv+gR+RR+R++a caar+F+L++eLG+++d++t+ WLlqq++pai ++tgt++ +a ++ +++ + ++ss++a+
MLOC_49381.1 9 PRNRDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETVRWLLQQSEPAIVAATGTGTVPAIAT-TVDGVLRIPTQSSSSAS 93
6999********************************************************77777333.33333333322222221 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03634 | 6.9E-31 | 11 | 91 | IPR005333 | Transcription factor, TCP |
| PROSITE profile | PS51369 | 26.932 | 11 | 65 | IPR017887 | Transcription factor TCP subgroup |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008361 | Biological Process | regulation of cell size | ||||
| GO:0048364 | Biological Process | root development | ||||
| GO:1900056 | Biological Process | negative regulation of leaf senescence | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MAVVRKPPPR NRDRHTKVEG RGRRIRMPAA CAARIFQLTR ELGHKSDGET VRWLLQQSEP 60 AIVAATGTGT VPAIATTVDG VLRIPTQSSS SASSAVVDDD ASAKRRRKL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}. | |||||
| UniProt | Transcription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00638 | PBM | Transfer from Lj0g3v0004489 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_49381.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020148818.1 | 8e-65 | transcription factor PCF2-like | ||||
| Swissprot | A2YXQ1 | 1e-59 | PCF2_ORYSI; Transcription factor PCF2 | ||||
| Swissprot | Q6ZBH6 | 1e-59 | PCF2_ORYSJ; Transcription factor PCF2 | ||||
| TrEMBL | A0A287SWJ0 | 9e-69 | A0A287SWJ0_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_49381.1 | 2e-72 | (Hordeum vulgare) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3912 | 31 | 67 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G51910.2 | 2e-43 | TCP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




