![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_52982.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 63aa MW: 7336.33 Da PI: 11.9703 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 27.5 | 7.5e-09 | 4 | 40 | 11 | 47 |
HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
l++d+ ++G g+W+ I+r Rt+ q+ s+ qky
MLOC_52982.1 4 LFLDGLDKYGRGDWRNISRFAVRSRTPTQVASHAQKY 40
8***********************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 13.589 | 1 | 45 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 9.79E-12 | 2 | 46 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.04E-6 | 3 | 41 | No hit | No description |
| TIGRFAMs | TIGR01557 | 3.9E-12 | 3 | 44 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-6 | 3 | 40 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 2.8E-6 | 4 | 40 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
MRRLFLDGLD KYGRGDWRNI SRFAVRSRTP TQVASHAQKY FIRQASAATR DSKRKSIHDI 60 TTP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_52982.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK367373 | 6e-96 | AK367373.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2055O05. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020158558.1 | 2e-35 | transcription factor DIVARICATA-like | ||||
| Swissprot | Q8S9H7 | 2e-22 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
| TrEMBL | M0WMN4 | 2e-38 | M0WMN4_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_52982.2 | 6e-37 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G09450.1 | 1e-24 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




