![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_5375.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 146aa MW: 16165.2 Da PI: 9.4329 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100 | 9e-32 | 46 | 96 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+
MLOC_5375.3 46 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 96
79***********************************************95 PP
| |||||||
| 2 | K-box | 20.7 | 1.7e-08 | 114 | 146 | 4 | 36 |
K-box 4 ssgks.leeakaeslqqelakLkkeienLqreqR 36
s++ ++e +a+++qqe++kL+++i++Lq+++R
MLOC_5375.3 114 SNS-GtVAEVNAQYYQQESSKLRQQISSLQNSNR 146
233.25999*********************9987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.711 | 38 | 98 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.6E-41 | 38 | 97 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.92E-33 | 39 | 110 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.64E-46 | 39 | 112 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 40 | 94 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-33 | 40 | 60 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.0E-27 | 47 | 94 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-33 | 60 | 75 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.4E-33 | 75 | 96 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0048366 | Biological Process | leaf development | ||||
| GO:0048440 | Biological Process | carpel development | ||||
| GO:0048443 | Biological Process | stamen development | ||||
| GO:0048497 | Biological Process | maintenance of floral organ identity | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MMSMMADLSC GASGVTVNDH QLTAPAPEES AVAGSEKMGR GRIEIKRIEN TTNRQVTFCK 60 RRNGLLKKAY ELSVLCDAEV ALVVFSSRGR LYEYSNNSVK ATIERYKKAN SDTSNSGTVA 120 EVNAQYYQQE SSKLRQQISS LQNSNR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 4e-22 | 38 | 125 | 1 | 91 | MEF2C |
| 5f28_B | 4e-22 | 38 | 125 | 1 | 91 | MEF2C |
| 5f28_C | 4e-22 | 38 | 125 | 1 | 91 | MEF2C |
| 5f28_D | 4e-22 | 38 | 125 | 1 | 91 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00609 | ChIP-seq | Transfer from AT4G18960 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_5375.3 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK374580 | 0.0 | AK374580.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3069K17. | |||
| GenBank | EU557050 | 0.0 | EU557050.1 Hordeum vulgare MIKC-type MADS-box transcription factor WM29B mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020153239.1 | 1e-101 | MADS-box transcription factor 3-like isoform X2 | ||||
| Swissprot | Q40704 | 1e-69 | MADS3_ORYSJ; MADS-box transcription factor 3 | ||||
| TrEMBL | A0A287KHZ3 | 1e-102 | A0A287KHZ3_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A453ED14 | 1e-102 | A0A453ED14_AEGTS; Uncharacterized protein | ||||
| TrEMBL | M0WQ96 | 1e-102 | M0WQ96_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_5375.2 | 1e-102 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18960.1 | 1e-68 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




