PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_57700.2

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

MIKC_MADS

Protein Properties

Length: 232aa MW: 26976.4 Da PI: 9.7442

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_57700.2	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.8	2.2e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+ MLOC_57700.2 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 59 79***********************************************95 PP
2	K-box	103.2	3.3e-34	76	173	3	100
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 +ss ++e +a+++qqe+akL+++i +Lq+++R l+G+ + ++s+++L+qLe +L+k+l kiR++Knell ++ie++q++e elq++n +Lr+k++ MLOC_57700.2 76 TSSAGTVAEINAQHYQQESAKLRQQITTLQNSNRTLIGDTMATMSHRDLKQLEGRLDKGLGKIRARKNELLSAEIEYMQRREMELQNNNFYLREKVA 172 4455559999*************************************************************************************98 PP K-box 100 e 100 e MLOC_57700.2 173 E 173 6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.711	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.6E-41	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.15E-32	2	73	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.75E-44	2	78	No hit	No description
PRINTS	PR00404	1.5E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.3E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-32	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	8.2E-26	86	171	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.868	87	177	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0090376	Biological Process	seed trichome differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 232 aa Download sequence Send to blast
MGRGRIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALVVFSS RGRLYEYSNN 60 SVKATIERYK KATSDTSSAG TVAEINAQHY QQESAKLRQQ ITTLQNSNRT LIGDTMATMS 120 HRDLKQLEGR LDKGLGKIRA RKNELLSAEI EYMQRREMEL QNNNFYLREK VAETERGQQQ 180 TLNMMGAAST SNEYEQNMIQ CDPRTFLQFN IMQQPQYYTQ QEDRKTFNSV ER

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_A	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	3e-20	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_57700.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK375322	0.0	AK375322.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3091A04.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020176047.1	1e-153	MADS-box transcription factor 58-like isoform X1
Swissprot	Q2V0P1	1e-138	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A287F101	1e-170	A0A287F101_HORVV; Uncharacterized protein
TrEMBL	F2EGP5	1e-170	F2EGP5_HORVV; Predicted protein
STRING	MLOC_57700.1	1e-171	(Hordeum vulgare)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	3e-97	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]