![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_59246.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 87aa MW: 9132.93 Da PI: 8.503 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 56.8 | 4.6e-18 | 1 | 38 | 22 | 59 |
EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
rsYY+Ct ++C+v+k++er+++dp++v +tY+g+Hnh+
MLOC_59246.1 1 RSYYKCTAENCNVRKQIERASTDPRCVLTTYTGRHNHD 38
9************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00774 | 6.7E-8 | 1 | 39 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 9.15E-14 | 1 | 40 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.2E-11 | 1 | 38 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 20.507 | 1 | 40 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 7.9E-16 | 1 | 40 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
RSYYKCTAEN CNVRKQIERA STDPRCVLTT YTGRHNHDPP GRGAGAAAAA GAGGGSSSDP 60 VPSTVNPSAS TLHQPSGIHQ LKEENRD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-14 | 1 | 40 | 38 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-14 | 1 | 40 | 38 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_59246.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK363803 | 1e-143 | AK363803.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2019A07. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020197516.1 | 2e-39 | probable WRKY transcription factor 58 | ||||
| TrEMBL | A0A287SEN1 | 3e-55 | A0A287SEN1_HORVV; Uncharacterized protein | ||||
| TrEMBL | M0XDY2 | 3e-57 | M0XDY2_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_59246.1 | 5e-58 | (Hordeum vulgare) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2875 | 32 | 36 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03340.1 | 8e-16 | WRKY DNA-binding protein 3 | ||||




