![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_59663.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 46aa MW: 5294.11 Da PI: 8.9311 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 35.9 | 1.7e-11 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
+g W++eEde+l + ++++G g+W+++++ g
MLOC_59663.1 14 KGLWSPEEDEKLMNHITKHGHGCWSSVPKLAG 45
688*************************9987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.5E-16 | 6 | 43 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 7.18E-10 | 7 | 44 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 14.995 | 9 | 46 | IPR017930 | Myb domain |
| Pfam | PF00249 | 9.0E-9 | 14 | 45 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.65E-5 | 17 | 45 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0001944 | Biological Process | vasculature development | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0010089 | Biological Process | xylem development | ||||
| GO:0010119 | Biological Process | regulation of stomatal movement | ||||
| GO:0010214 | Biological Process | seed coat development | ||||
| GO:0048364 | Biological Process | root development | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 46 aa Download sequence Send to blast |
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSSV PKLAGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269|PubMed:16005292, ECO:0000269|PubMed:19401413, ECO:0000269|PubMed:22708996, ECO:0000269|PubMed:23741471, ECO:0000269|PubMed:28207974}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00134 | DAP | Transfer from AT1G09540 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_59663.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK250733 | 1e-68 | AK250733.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf88d11, mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001303169.1 | 4e-26 | transcription repressor MYB6-like | ||||
| Swissprot | Q8VZQ2 | 5e-25 | MYB61_ARATH; Transcription factor MYB61 | ||||
| TrEMBL | A0A1E5VVV8 | 2e-25 | A0A1E5VVV8_9POAL; Transcription factor MYB86 | ||||
| TrEMBL | A0A3L6DLG3 | 2e-25 | A0A3L6DLG3_MAIZE; Transcription factor MYB61 | ||||
| TrEMBL | A0A446JLU9 | 2e-25 | A0A446JLU9_TRITD; Uncharacterized protein | ||||
| STRING | XP_006423960.1 | 3e-25 | (Citrus clementina) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G57560.1 | 2e-27 | myb domain protein 50 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




