PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_59912.1

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

MYB_related

Protein Properties

Length: 148aa MW: 16522.9 Da PI: 10.6988

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_59912.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.6	6e-18	80	124	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r rW++eE+e+++da ++G + Wk+I +++ ++t+ q++s+ qky MLOC_59912.1 80 RERWSPEEHERFLDALLRFGRD-WKKIEEHVR-TKTAVQIRSHAQKY 124 78****************77.*****.***********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	3.96E-18	74	130	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.963	75	129	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	6.3E-10	78	131	IPR009057	Homeodomain-like
SMART	SM00717	1.0E-11	79	127	IPR001005	SANT/Myb domain
TIGRFAMs	TIGR01557	1.2E-17	79	127	IPR006447	Myb domain, plants
Pfam	PF00249	5.8E-15	80	124	IPR001005	SANT/Myb domain
CDD	cd00167	8.19E-10	82	125	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MGSRGAACVY IYVRGCRASL GIESDERLAS AREDRPSLLA CLLAGSWSIM AERGGGGEGE 60 GTSSSPGKKA RKPYTITRPR ERWSPEEHER FLDALLRFGR DWKKIEEHVR TKTAVQIRSH 120 AQKYFLKVQR LGLAAGLPPP QHPSRRHA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:21474993, ECO:0000269\|PubMed:21483796, ECO:0000269\|PubMed:23638299}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_59912.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269\|PubMed:21205033, ECO:0000269\|PubMed:22902701, ECO:0000269\|PubMed:23638299}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020153532.1	3e-48	protein REVEILLE 8-like
Swissprot	Q8RWU3	9e-30	RVE8_ARATH; Protein REVEILLE 8
TrEMBL	A0A287KGP4	1e-100	A0A287KGP4_HORVV; Uncharacterized protein
STRING	MLOC_59912.1	1e-104	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3642	31	70

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G09600.1	1e-31	MYB_related family protein

Publications ? help Back to Top
Manfield IW, et al. Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis. Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9 [PMID:16845059] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Fogelmark K,Troein C Rethinking transcriptional activation in the Arabidopsis circadian clock. PLoS Comput. Biol., 2014. 10(7): p. e1003705 [PMID:25033214] Xing H, et al. LNK1 and LNK2 recruitment to the evening element require morning expressed circadian related MYB-like transcription factors. Plant Signal Behav, 2015. 10(3): p. e1010888 [PMID:25848708] Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size. Plant Physiol., 2017. 173(4): p. 2308-2322 [PMID:28254761]