![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_60198.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 178aa MW: 19996.4 Da PI: 5.3942 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 100 | 1.6e-31 | 1 | 52 | 4 | 55 |
G2-like 4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+rWtpeLHerFv+av+ LGGsekAtPk +l+lmk + Lt++hvkSHLQkYR+
MLOC_60198.3 1 MRWTPELHERFVDAVNLLGGSEKATPKGVLKLMKADNLTIYHVKSHLQKYRT 52
79*************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| TIGRFAMs | TIGR01557 | 2.0E-23 | 1 | 52 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-28 | 1 | 54 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 14.138 | 1 | 55 | IPR017930 | Myb domain |
| Pfam | PF00249 | 3.9E-10 | 1 | 51 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 4.3E-16 | 1 | 52 | IPR009057 | Homeodomain-like |
| Pfam | PF14379 | 1.2E-22 | 84 | 129 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 178 aa Download sequence Send to blast |
MRWTPELHER FVDAVNLLGG SEKATPKGVL KLMKADNLTI YHVKSHLQKY RTARYRPELS 60 EGSSERLEAS KEDLPSIDLK GNFDLTEALR LQLELQKRLH EQLEVQRSLQ LRIEEQGKCL 120 QIMIEQQCNP AADKALDAST SAEGSKLPSD PPESSTVKDV PNNSQNGTTE RAESGDKE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 1e-30 | 1 | 56 | 5 | 60 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis. PHR2 binding to DNA is repressed redundantly by SPX1, SPX2 and SPX4 in a PI-dependent manner. {ECO:0000250|UniProtKB:Q6Z156}. | |||||
| UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:25657119, PubMed:26082401). Functionally redundant with PHR1 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). Involved in both systematic and local Pi-signaling pathways (PubMed:19704822). Regulates several Pi transporters (PubMed:18263782). Regulates the expression of PT2 (PubMed:20149131). Directly up-regulates SPX1 and SPX2 expression, but PHR2 binding to DNA is repressed redundantly by SPX1 and SPX2 in a PI-dependent manner (PubMed:25271318). The DNA-binding activity is also repressed by SPX4 (PubMed:24692424). Involved in root growth under Pi deprivation (PubMed:18263782). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:19704822, ECO:0000269|PubMed:20149131, ECO:0000269|PubMed:24692424, ECO:0000269|PubMed:25271318, ECO:0000269|PubMed:25657119, ECO:0000269|PubMed:26082401}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_60198.3 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK250181 | 0.0 | AK250181.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf70h19, mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020191223.1 | 1e-122 | protein PHOSPHATE STARVATION RESPONSE 2-like isoform X1 | ||||
| Swissprot | B8B5N8 | 1e-106 | PHR2_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 2 | ||||
| Swissprot | Q6Z156 | 1e-106 | PHR2_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 2 | ||||
| TrEMBL | A0A287KBS8 | 1e-125 | A0A287KBS8_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_60198.1 | 1e-128 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G28610.1 | 1e-63 | phosphate starvation response 1 | ||||




