![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_62500.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 56aa MW: 6410.33 Da PI: 8.2279 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 40.8 | 3.9e-13 | 4 | 48 | 42 | 87 |
TS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
B3 42 sgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
s rsW v +++ ++ +++ +kGWk+F+++n+++egD ++Fk++++
MLOC_62500.1 4 SARSWPVAFNIANTY-GFLTGKGWKRFCQDNEVEEGDRCTFKVVEK 48
669******655554.58999*********************7653 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50863 | 12.478 | 1 | 56 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 3.3E-13 | 4 | 55 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 1.35E-12 | 4 | 55 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 7.5E-11 | 4 | 47 | IPR003340 | B3 DNA binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
MGGSARSWPV AFNIANTYGF LTGKGWKRFC QDNEVEEGDR CTFKVVEKMV WHVVIN |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_62500.1 |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020194548.1 | 2e-31 | putative B3 domain-containing protein Os06g0632500 | ||||
| TrEMBL | A0A287XCA2 | 5e-36 | A0A287XCA2_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A287XCI6 | 1e-36 | A0A287XCI6_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_62500.2 | 1e-36 | (Hordeum vulgare) | ||||




