PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_64240.1

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

NAC

Protein Properties

Length: 161aa MW: 18298 Da PI: 10.1394

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_64240.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	170.9	3.9e-53	13	142	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhP+d+el+++yL++kv+gk ++ + + +vd++kvePwdLp +++ + kewyf+s +d+kyatg+r+nrat sgyWkatgkd+ v + MLOC_64240.1 13 LPPGFRFHPRDDELICDYLAPKVTGKVgFSGRRPpMVDVDLNKVEPWDLPVTASVGGKEWYFYSLKDRKYATGQRTNRATVSGYWKATGKDRVVAR- 108 79**********************986665656***********8888899*******************************9999. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrle 129 +g+lvg++ktLvfy+grapkg+kt+Wvmheyrle MLOC_64240.1 109 RGALVGMRKTLVFYQGRAPKGRKTEWVMHEYRLE 142 999***************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.35E-55	2	154	IPR003441	NAC domain
PROSITE profile	PS51005	50.618	13	161	IPR003441	NAC domain
Pfam	PF02365	1.9E-27	14	141	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 161 aa Download sequence Send to blast
MSMSFLSMVE TELPPGFRFH PRDDELICDY LAPKVTGKVG FSGRRPPMVD VDLNKVEPWD 60 LPVTASVGGK EWYFYSLKDR KYATGQRTNR ATVSGYWKAT GKDRVVARRG ALVGMRKTLV 120 FYQGRAPKGR KTEWVMHEYR LEGAHEQASK VIADTKTLDH A

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-47	9	141	11	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269\|PubMed:11114891}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_64240.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by auxin.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK250475	0.0	AK250475.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf77e13, mRNA sequence.
GenBank	AM500855	0.0	AM500855.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (nac1 gene).

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020198650.1	1e-109	NAC domain-containing protein 21/22-like isoform X1
Swissprot	Q84TE6	5e-72	NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBL	A0A446SPJ8	1e-109	A0A446SPJ8_TRITD; Uncharacterized protein
STRING	Traes_5BS_9F043AE17.1	1e-109	(Triticum aestivum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G56010.2	2e-74	NAC domain containing protein 1

Publications ? help Back to Top
Le Hénanff G, et al. Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance. J. Exp. Bot., 2013. 64(16): p. 4877-93 [PMID:24043850] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Huo X,Wang C,Teng Y,Liu X Identification of miRNAs associated with dark-induced senescence in Arabidopsis. BMC Plant Biol., 2015. 15: p. 266 [PMID:26530097] Chen X, et al. Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis. Plant Physiol., 2016. 170(4): p. 2136-45 [PMID:26850273] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985]