![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_64571.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 87aa MW: 10297.7 Da PI: 10.6036 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 53.2 | 6.5e-17 | 5 | 60 | 3 | 58 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58
+ +r++r++kNRe+A rsR+RK+a+i+eLe v +Le+eN L ke ee ++ k
MLOC_64571.1 5 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAHLSKEQEEANQRRLK 60
689*******************************************9998886544 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 7.6E-10 | 3 | 68 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 9.8E-16 | 5 | 65 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.174 | 5 | 69 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 4.94E-12 | 7 | 56 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 3.7E-15 | 8 | 64 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 10 | 25 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MDRAAMQRQK RMIKNRESAA RSRERKQAYI AELESLVTQL EEENAHLSKE QEEANQRRLK 60 ELKEKVTPVI IVKTSSQGLR RTNSMEW |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_64571.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK368005 | 1e-146 | AK368005.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2066C11. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020174700.1 | 5e-51 | ABSCISIC ACID-INSENSITIVE 5-like protein 7 | ||||
| Swissprot | Q0JHF1 | 5e-44 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
| TrEMBL | A0A287LZN5 | 4e-54 | A0A287LZN5_HORVV; Uncharacterized protein | ||||
| TrEMBL | F2DVT7 | 5e-54 | F2DVT7_HORVV; Predicted protein | ||||
| STRING | MLOC_64571.1 | 7e-55 | (Hordeum vulgare) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2665 | 37 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G03970.1 | 4e-26 | G-box binding factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




