PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_64571.3

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

bZIP

Protein Properties

Length: 65aa MW: 7742.81 Da PI: 9.3074

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_64571.3	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	54.5	2.5e-17	5	56	3	54
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 + +r++r++kNRe+A rsR+RK+a+i+eLe v +Le+eN L ke ee ++ MLOC_64571.3 5 AMQRQKRMIKNRESAARSRERKQAYIAELESLVTQLEEENAHLSKEQEEANQ 56 689******************************************9998776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00041	9.7E-5	2	18	IPR001630	cAMP response element binding (CREB) protein
SMART	SM00338	1.2E-8	3	65	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.806	5	57	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	6.9E-16	5	56	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.13E-12	7	56	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.1E-15	8	56	No hit	No description
PROSITE pattern	PS00036	0	10	25	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	9.7E-5	20	40	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	9.7E-5	40	57	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 65 aa Download sequence Send to blast
MDRAAMQRQK RMIKNRESAA RSRERKQAYI AELESLVTQL EEENAHLSKE QEEANQRRLK 60 EVCLI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_64571.3

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK368005	1e-97	AK368005.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2066C11.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020174700.1	2e-34	ABSCISIC ACID-INSENSITIVE 5-like protein 7
Swissprot	Q0JHF1	2e-29	BZP12_ORYSJ; bZIP transcription factor 12
TrEMBL	A0A287LZN2	3e-37	A0A287LZN2_HORVV; Uncharacterized protein
TrEMBL	A0A453G0C0	2e-36	A0A453G0C0_AEGTS; Uncharacterized protein
STRING	MLOC_64571.1	4e-34	(Hordeum vulgare)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G03970.1	2e-21	G-box binding factor 4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]