PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_66648.1

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

bZIP

Protein Properties

Length: 67aa MW: 7796.94 Da PI: 10.9447

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_66648.1	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	49.3	1.1e-15	1	48	10	57
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 ++kNRe+A+rsR+RK+a + + e +v +L +eN++L+ + ++lk v+ MLOC_66648.1 1 MIKNRESASRSRARKQAHVTQIESEVHQLREENEQLRLKYDQLKASVE 48 68*****************************************98776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.6E-6	1	56	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	5.3E-14	1	48	No hit	No description
Pfam	PF00170	3.0E-13	1	48	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.0E-12	1	47	No hit	No description
PROSITE profile	PS50217	10.174	1	48	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MIKNRESASR SRARKQAHVT QIESEVHQLR EENEQLRLKY DQLKASVEVS VPVPVRKTLQ 60 RVLSAPF

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the transition to flowering promoted by FT. {ECO:0000269\|PubMed:16099979, ECO:0000269\|PubMed:16099980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_66648.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK373425	1e-110	AK373425.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3030J14.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020151150.1	5e-36	protein ABSCISIC ACID-INSENSITIVE 5-like
Swissprot	Q84JK2	3e-13	FD_ARATH; Protein FD
TrEMBL	F2EBA0	4e-39	F2EBA0_HORVV; Predicted protein
TrEMBL	M0Y874	2e-39	M0Y874_HORVV; Uncharacterized protein
STRING	BRADI4G36587.1	2e-28	(Brachypodium distachyon)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G35900.1	1e-15	bZIP family protein

Publications ? help Back to Top
Ho WW,Weigel D Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T. Plant Cell, 2014. 26(2): p. 552-64 [PMID:24532592] Ji H, et al. Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis. BMC Plant Biol., 2014. 14: p. 237 [PMID:25201173] Li L, et al. Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis. BMC Plant Biol., 2014. 14: p. 381 [PMID:25547226] Sussmilch FC, et al. Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development. Plant Cell, 2015. 27(4): p. 1046-60 [PMID:25804541] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Kawamoto N,Endo M,Araki T Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering. Plant Signal Behav, 2015. 10(12): p. e1086856 [PMID:26440648] Zhang L,Yu H,Lin S,Gao Y Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis. Front Plant Sci, 2016. 7: p. 8 [PMID:26834775] Hou CJ,Yang CH Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1. Plant Mol. Biol., 2016. 91(4-5): p. 563-79 [PMID:27216814] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142] Jang S,Li HY,Kuo ML Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets. Sci Rep, 2017. 7: p. 44477 [PMID:28290557]