![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_67851.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 207aa MW: 22633.9 Da PI: 9.2344 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 107.1 | 8.9e-34 | 23 | 81 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
MLOC_67851.1 23 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDLRAVITTYEGKHNHD 81
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 9.9E-38 | 8 | 83 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 4.45E-30 | 15 | 83 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 38.411 | 18 | 83 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.1E-38 | 23 | 82 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 5.3E-26 | 24 | 81 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009409 | Biological Process | response to cold | ||||
| GO:0009414 | Biological Process | response to water deprivation | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0009788 | Biological Process | negative regulation of abscisic acid-activated signaling pathway | ||||
| GO:0009938 | Biological Process | negative regulation of gibberellic acid mediated signaling pathway | ||||
| GO:0010120 | Biological Process | camalexin biosynthetic process | ||||
| GO:0010200 | Biological Process | response to chitin | ||||
| GO:0010508 | Biological Process | positive regulation of autophagy | ||||
| GO:0042742 | Biological Process | defense response to bacterium | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0070370 | Biological Process | cellular heat acclimation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 207 aa Download sequence Send to blast |
MAGNRTVREP RVVVQTMSDI DILDDGYRWR KYGQKVVKGN PNPRSYYKCT TVGCPVRKHV 60 ERASHDLRAV ITTYEGKHNH DVPAARGSAA LYRPAPRAAD STASTGHYLN PQPSAMAYQT 120 GTGGPNVAAA GTQQYAPRPD GFGGQNQGFS GPGFNGGFGF SGPGFDNPTA SYMSQHQQQQ 180 RQNDAMHASS AKEELREEDM FFQNSQY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-38 | 14 | 84 | 8 | 78 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-38 | 14 | 84 | 8 | 78 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor (By similarity). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (By similarity). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000250|UniProtKB:Q6QHD1}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00299 | DAP | Transfer from AT2G38470 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_67851.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:25110688). Slightly down-regulated by gibberellic acid (GA) (By similarity). Accumulates in response to jasmonic acid (MeJA) (PubMed:16919842). {ECO:0000250|UniProtKB:Q6IEQ7, ECO:0000269|PubMed:16919842, ECO:0000269|PubMed:25110688}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK357671 | 0.0 | AK357671.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1058P10. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020154000.1 | 1e-135 | WRKY transcription factor WRKY24-like | ||||
| Swissprot | Q6B6R4 | 2e-69 | WRK24_ORYSI; WRKY transcription factor WRKY24 | ||||
| TrEMBL | A0A287M513 | 1e-153 | A0A287M513_HORVV; Uncharacterized protein | ||||
| STRING | Traes_3B_990298FF5.1 | 1e-132 | (Triticum aestivum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38470.1 | 1e-56 | WRKY DNA-binding protein 33 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




