![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_6821.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 119aa MW: 13564.2 Da PI: 8.2414 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 59.3 | 8.8e-19 | 45 | 92 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT eEd+ lv++++ +G g+W++ ar g++Rt+k+c++rw++yl
MLOC_6821.3 45 RGPWTVEEDLTLVNYIADHGDGRWNSLARGAGLKRTGKSCRLRWLNYL 92
89*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 23.304 | 40 | 96 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-22 | 40 | 95 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 9.8E-15 | 44 | 94 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.7E-17 | 45 | 92 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.92E-22 | 46 | 119 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.33E-12 | 47 | 92 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-7 | 96 | 119 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MASWSSSSTQ RRSGVSSGAT MPCSVMKFDD DLLRHEEEAA EEIRRGPWTV EEDLTLVNYI 60 ADHGDGRWNS LARGAGLKRT GKSCRLRWLN YLRPDVKRGN FTADEQLLIL DLHSRWGNR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 5e-16 | 42 | 119 | 24 | 100 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may be involved in the jasmonate-dependent defense responses to the rice blast fungus Magnaporthe oryzae. Does not seem to function in the salicylic acid-dependent signaling pathway. {ECO:0000269|PubMed:11310740}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_6821.3 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by jasmonate (JA), wounding and infection by the fungal pathogen Magnaporthe oryzae. {ECO:0000269|PubMed:11310740}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK360551 | 0.0 | AK360551.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1120I18. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020162380.1 | 8e-62 | myb-related protein 340-like | ||||
| Swissprot | Q2QZJ8 | 6e-48 | JAMYB_ORYSJ; Transcription factor JAMYB | ||||
| TrEMBL | M0YDN6 | 3e-82 | M0YDN6_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_6821.2 | 1e-81 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27810.1 | 6e-44 | myb domain protein 21 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




