![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_68487.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | SRS | ||||||||
| Protein Properties | Length: 80aa MW: 8447.42 Da PI: 6.227 | ||||||||
| Description | SRS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF702 | 84.2 | 3.3e-26 | 4 | 57 | 101 | 154 |
DUF702 101 etsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
++++P+evsseavfrcvr++ vd++e+elaYqt+vsigGhvfkGiL+d G+++
MLOC_68487.2 4 VAERFPREVSSEAVFRCVRLGPVDQAEAELAYQTTVSIGGHVFKGILHDVGPSS 57
5688***********************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05142 | 5.2E-23 | 5 | 56 | IPR007818 | Protein of unknown function DUF702 |
| TIGRFAMs | TIGR01624 | 2.0E-24 | 7 | 55 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MVTVAERFPR EVSSEAVFRC VRLGPVDQAE AELAYQTTVS IGGHVFKGIL HDVGPSSNAH 60 AQLQAAAGGS GSDYQFRLTG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Regulates anther dehiscence and floral development. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:20706774}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_68487.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK241285 | 5e-63 | AK241285.1 Oryza sativa Japonica Group cDNA, clone: J065137A19, full insert sequence. | |||
| GenBank | AP005314 | 5e-63 | AP005314.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0515E01. | |||
| GenBank | AP005567 | 5e-63 | AP005567.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1254_E07. | |||
| GenBank | AP014965 | 5e-63 | AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012617 | 5e-63 | CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020192267.1 | 4e-39 | protein SHI RELATED SEQUENCE 1-like | ||||
| Swissprot | Q9FXH7 | 1e-17 | SRS7_ARATH; Protein SHI RELATED SEQUENCE 7 | ||||
| TrEMBL | A0A1I9RHF0 | 2e-48 | A0A1I9RHF0_HORVU; SHI | ||||
| TrEMBL | A0A1I9RHF6 | 2e-48 | A0A1I9RHF6_HORVU; SHI | ||||
| TrEMBL | A0A1I9RHG0 | 2e-48 | A0A1I9RHG0_HORVU; SHI | ||||
| TrEMBL | A0A1I9RHG5 | 2e-48 | A0A1I9RHG5_HORVU; SHI | ||||
| TrEMBL | A0A1I9RHG8 | 2e-48 | A0A1I9RHG8_HORVU; SHI | ||||
| TrEMBL | A0A287S092 | 2e-48 | A0A287S092_HORVV; Uncharacterized protein | ||||
| TrEMBL | A0A287S098 | 6e-50 | A0A287S098_HORVV; Uncharacterized protein | ||||
| STRING | MLOC_68487.1 | 3e-50 | (Hordeum vulgare) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66350.1 | 3e-19 | Lateral root primordium (LRP) protein-related | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




