![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MLOC_68772.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 76aa MW: 8876.08 Da PI: 10.0285 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 30.7 | 7.3e-10 | 31 | 70 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+T+ E++l + +++ G++ W++Ia +++ gRt++++ +w
MLOC_68772.1 31 FTEAEEDLVFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWA 70
9******************.*********.*******98886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 9.272 | 23 | 76 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.7E-7 | 27 | 75 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 6.3E-9 | 31 | 70 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.0E-12 | 31 | 71 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.79E-7 | 31 | 69 | No hit | No description |
| SuperFamily | SSF46689 | 6.63E-9 | 31 | 72 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0010026 | Biological Process | trichome differentiation | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0048765 | Biological Process | root hair cell differentiation | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MSSKSLGKNS KIMSGRERKE VNSNAKHFVD FTEAEEDLVF RMHRLVGNRW ELIAGRIPGR 60 TAEEVEMFWA KKHQDQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | MLOC_68772.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK248836 | 1e-126 | AK248836.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf6c21, mRNA sequence. | |||
| GenBank | AK370851 | 1e-126 | AK370851.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2118H15. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020165156.1 | 9e-47 | MYB-like transcription factor TCL2 | ||||
| Refseq | XP_020165157.1 | 9e-47 | MYB-like transcription factor TCL2 | ||||
| Refseq | XP_020172618.1 | 9e-47 | MYB-like transcription factor TCL2 | ||||
| Refseq | XP_020172619.1 | 9e-47 | MYB-like transcription factor TCL2 | ||||
| Swissprot | B3H4X8 | 2e-18 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
| TrEMBL | F2E3X7 | 5e-49 | F2E3X7_HORVV; Predicted protein | ||||
| STRING | MLOC_68772.1 | 9e-50 | (Hordeum vulgare) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5275 | 31 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G01060.1 | 3e-22 | CAPRICE-like MYB3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




