PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MLOC_69570.2

Organism

Hordeum vulgare

Taxonomic ID

4513

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

MYB_related

Protein Properties

Length: 88aa MW: 10056.6 Da PI: 9.4056

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_69570.2	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.6	1.3e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ ++k +G g+W++ ++ g+ R++k+c++rw +yl MLOC_69570.2 14 KGAWTKEEDQRLIGYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 61 79****************************99**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.1E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.28	9	65	IPR017930	Myb domain
SMART	SM00717	1.7E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	6.1E-16	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.87E-22	15	88	IPR009057	Homeodomain-like
CDD	cd00167	4.79E-10	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.3E-9	65	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	8.954	66	88	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDQRLIGYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWMNY 60 LRPDLKRGNF TDDDDELIIK LHALLGNK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-17	13	88	26	100	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_69570.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK355449	1e-146	AK355449.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1020M13.
GenBank	AK361531	1e-146	AK361531.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1142O19.
GenBank	AK361613	1e-146	AK361613.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1144P14.
GenBank	AK362279	1e-146	AK362279.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2003O24.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020200984.1	9e-60	myb-related protein 308-like
Swissprot	Q9SZP1	5e-56	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A453G1M5	2e-59	A0A453G1M5_AEGTS; Uncharacterized protein
STRING	Traes_3B_5CB4803CD.2	7e-60	(Triticum aestivum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	2e-58	myb domain protein 4

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]