PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_69621.3
Organism
Hordeum vulgare
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 90aa    MW: 9899.92 Da    PI: 4.0946
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_69621.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.43.6e-164590248
           NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                  +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp
  MLOC_69621.3 45 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELP 90
                  79***************************.89**************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100520.3174490IPR003441NAC domain
SuperFamilySSF1019412.22E-164490IPR003441NAC domain
PfamPF023658.3E-84686IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MSRDIDEGSV SAATAGGGGG EVGGEPAAGV GDEAAVDSHE NDLVMPGFRF HPTEEELIEF  60
YLRRKVEGRR FNVELITFLD LYRFDPWELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-1446901761Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_69621.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-125HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231368.16e-39NAC domain-containing protein 22 isoform X2
RefseqXP_014753810.16e-39NAC domain-containing protein 22 isoform X1
SwissprotQ9ZVP82e-28NAC35_ARATH; NAC domain-containing protein 35
TrEMBLA0A287FYY57e-57A0A287FYY5_HORVV; Uncharacterized protein
TrEMBLM0YID13e-56M0YID1_HORVV; Uncharacterized protein
STRINGMLOC_69621.25e-57(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.27e-29NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]